NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208407_1032352

Scaffold Ga0208407_1032352


Overview

Basic Information
Taxon OID3300026257 Open in IMG/M
Scaffold IDGa0208407_1032352 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1809
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NamePacific Ocean: Eastern Tropical North Pacific
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000464Metagenome / Metatranscriptome1105Y

Sequences

Protein IDFamilyRBSSequence
Ga0208407_10323522F000464N/AMKLSQHQKIRMYSHHDRHVDGFEEDFWPMMGILSTIWGAWTGAIHLIDWLTFDAIVWWVEPFTIVPVIFLIVMKENYDSLNPLHWWPLFWGYNAKLPDEDRITIRPIDSERIMQQHGGRLNVHIIDYEHIKFRRKKDAVIFGLKYF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.