


| Basic Information | |
|---|---|
| Taxon OID | 3300025886 Open in IMG/M |
| Scaffold ID | Ga0209632_10096102 Open in IMG/M |
| Source Dataset Name | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1740 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Helgoland, sampling site Kabeltonne | |||||||
| Coordinates | Lat. (o) | 54.184167 | Long. (o) | 7.9 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025856 | Metagenome | 200 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209632_100961025 | F025856 | GGA | MEMSRIEPNTYAFIVKEGYDHPAVVMLEGEYKNVAWGYTSVNIPTVNDSKDNAKLQWEFEIIDSAGREWNEFKNQTFVDLMGDILSDQIDEQLEAGTLKFGNGDG |
| ⦗Top⦘ |