NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208646_1026181

Scaffold Ga0208646_1026181


Overview

Basic Information
Taxon OID3300025425 Open in IMG/M
Scaffold IDGa0208646_1026181 Open in IMG/M
Source Dataset NameSaline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1318
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAce Lake, Antarctica
CoordinatesLat. (o)-68.4725Long. (o)78.188Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005795Metagenome390Y

Sequences

Protein IDFamilyRBSSequence
Ga0208646_10261813F005795N/AMLVRVVVTYALLTVCAIAMHDNTYAVFELREQLLTLTLNPWELLDQLRYASEPLRQRVYLDIAMIQSEIRDTIAELIRLDRLEH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.