NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209341_10830942

Scaffold Ga0209341_10830942


Overview

Basic Information
Taxon OID3300025325 Open in IMG/M
Scaffold IDGa0209341_10830942 Open in IMG/M
Source Dataset NameSoil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)697
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, Colorado, United States
CoordinatesLat. (o)39.53Long. (o)-107.78Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080996Metagenome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0209341_108309421F080996N/AAPPQPAGGGGQLVRFARIGVLPQDSEIIGAPDAAHIAAPPPDPTTMRYGVLLELELIWQSLGAQAGDTLYSVSLGPGDEVKLVVSDGRWRKKPVAHDRPLQIVAKMAGARQLGDGLDAVPLDSCVPSDLPGAAVETVRLLAERTTRMCEALRRRPLVITELEGDKPSGSSIRTLRNMRSEGVLTYHFIEPVERYRVIVRTPRLRAALLVPFRLPNIATREVVRRFGYALRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.