


| Basic Information | |
|---|---|
| Taxon OID | 3300025310 Open in IMG/M |
| Scaffold ID | Ga0209172_10030220 Open in IMG/M |
| Source Dataset Name | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3625 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: British Columbia | |||||||
| Coordinates | Lat. (o) | 60.1987 | Long. (o) | -125.5127 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027040 | Metagenome | 196 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209172_100302202 | F027040 | AGGAGG | MGRTKEEPRGALATVQEMLTGGGKLLVDQAQTLRDVVGRRIVDVGRAAEEQAVGLVGALEEQLGQRLDVLLNRLAVSLRRDVDRVRERVRALENRLADVPKEGLRELIAPLQAIASGASERASAAIARDEELATRLQHLERRVAEITRETSQETLDAQEIRQKLERADQRLTDLGRELGTKLGELGALRERLTRIEGRVVDGSKEQIARAGEFAGFRDRITRLEARLSDLSKEQLARSVETAGLRERLFRLEQNRSAAGPQPAATFIDQPSAAMDE |
| ⦗Top⦘ |