


| Basic Information | |
|---|---|
| Taxon OID | 3300025278 Open in IMG/M |
| Scaffold ID | Ga0207417_1031865 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Deep Pacific Ocean - MSP-82 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 876 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -25.4941 | Long. (o) | -179.5286 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041307 | Metagenome | 160 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207417_10318652 | F041307 | GGA | MTNVRTDEPVLFCGAATGYDTRVSPLPKCWLEMSKQEQTKHRKFKKAEYEALNPKKLDYKVIGTKRYKKSY |
| ⦗Top⦘ |