


| Basic Information | |
|---|---|
| Taxon OID | 3300025260 Open in IMG/M |
| Scaffold ID | Ga0207895_1045040 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Deep Pacific Ocean - MSP112 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 736 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 15.9164 | Long. (o) | -124.5211 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060865 | Metagenome / Metatranscriptome | 132 | N |
| F064679 | Metagenome / Metatranscriptome | 128 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207895_10450401 | F064679 | N/A | NLLSLYMPQKSIDLLTPKRSLIDLSVPPEGSFDSTIIGYKMCKLMEDVILCKYKDETEDGTALIRNGIHIPLNVDTKAWRIGEVLLAGTKCEYVEVGDHVCFPNNLGIPIANLDVQDIGKVRKGIFLNESRIFGIVKPFESK |
| Ga0207895_10450402 | F060865 | GGA | LKVSRSQLLTLLKNNVCEIKFVRRVFKSGAPPTRRMLCTNSFTLLNSVNGRLTLNFRPTSRFQDYNPAVKNLIIVWDLFMQNYRQINCDNVELIETIPATDEFWEYY |
| ⦗Top⦘ |