


| Basic Information | |
|---|---|
| Taxon OID | 3300025135 Open in IMG/M |
| Scaffold ID | Ga0209498_1092075 Open in IMG/M |
| Source Dataset Name | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1249 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Hawthorne, Nevada | |||||||
| Coordinates | Lat. (o) | 38.7 | Long. (o) | -118.7 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003027 | Metagenome / Metatranscriptome | 512 | Y |
| F006543 | Metagenome / Metatranscriptome | 370 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209498_10920751 | F006543 | AGG | MKKFSFVVDIVADDLDRDEVVGSIRSCLSESLSSDIHANVKAGEVKAFSEQGYKVWRARVTGVTAEQAGDAHNSKIEAEAVA |
| Ga0209498_10920754 | F003027 | AGGAG | MKTANGNDKLGKENCIVVSRPVGDTCPSDCDFLGNGCYAEDLENIYPGVRPAGMQNLITEKNRIRSMLVDAVKKNKDVRWHERGDFFKYGELDNEYVDNVLWACESILADGGSLPTMWAYTHIYDTRLSMELGKYVNMYASVHNGEHMKKA |
| ⦗Top⦘ |