


| Basic Information | |
|---|---|
| Taxon OID | 3300025104 Open in IMG/M |
| Scaffold ID | Ga0209721_1001735 Open in IMG/M |
| Source Dataset Name | Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Tshipise hot spring metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 15338 |
| Total Scaffold Genes | 20 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (30.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Africa: Tshipise | |||||||
| Coordinates | Lat. (o) | -22.6092 | Long. (o) | 30.1749 | Alt. (m) | Depth (m) | 2 to 3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008501 | Metagenome | 332 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209721_100173513 | F008501 | AGGAGG | MLERMYKKSAVDLTDLALGVVVLGIVVSVGVTILTNIRDTNQPNSPAYNITNMAANGLAEYGNWFKIIVIIGVAAVILALIFMAFGKGSNTVGSTY |
| ⦗Top⦘ |