


| Basic Information | |
|---|---|
| Taxon OID | 3300025005 Open in IMG/M |
| Scaffold ID | Ga0210005_1107620 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 0.2 um filter (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 728 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → Gallionellales bacterium RBG_16_57_15 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Utah | |||||||
| Coordinates | Lat. (o) | 38.9383 | Long. (o) | -110.1342 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054576 | Metagenome / Metatranscriptome | 139 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0210005_11076201 | F054576 | AGGA | MEFQLGLIELIAFAGANIGGGWALLRISFTQFELRLDDRFELLDNAMADVKRIELEIVRADTRNAQTYVTQTSHDKGLERIFNVLSSMEQKLDGKANADDCEAKHLRHMERK |
| ⦗Top⦘ |