


| Basic Information | |
|---|---|
| Taxon OID | 3300024344 Open in IMG/M |
| Scaffold ID | Ga0209992_10071963 Open in IMG/M |
| Source Dataset Name | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1594 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kolumbo volcano, Aegean Sea | |||||||
| Coordinates | Lat. (o) | 36.5264 | Long. (o) | 25.4868 | Alt. (m) | Depth (m) | 470 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043973 | Metagenome / Metatranscriptome | 155 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209992_100719634 | F043973 | AGGAG | MKKLDDLGKMIKMENLVPIILGVALSGLGTLMNFAYSNIEELHKEVVEHRLLLSRLISPDGKLIQSPTSAASKTALNKEISDLKKDVAVLQTKIDYLKGLK |
| ⦗Top⦘ |