


| Basic Information | |
|---|---|
| Taxon OID | 3300024331 Open in IMG/M |
| Scaffold ID | Ga0247668_1014004 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1662 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Indiana | |||||||
| Coordinates | Lat. (o) | 40.4449 | Long. (o) | -87.0297 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000823 | Metagenome / Metatranscriptome | 875 | Y |
| F000825 | Metagenome / Metatranscriptome | 874 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247668_10140041 | F000823 | N/A | LREVRMRFGAIGCVVGAAFLAMTAPAQAAWHGYISHALGFAFAAPGEMKIEKGKYQGAVAGARDTTIYRFLDDNIEYKVIVVDTTAEANQAATLLGEAEYIFQDQKKLLMDAFGRVDGKYGRKLTIDLPNNGGRTTAAFWFVNGRIVSLQATVLPANGDYDTPEMARFVDSITFYTVRAADDAIEVPVPK |
| Ga0247668_10140042 | F000825 | GGAGG | MRRFAIAALVSASLAAMTAPAEAAWKSYVSHPLGFSFEMPGVVKSQMGTYRGSVAGPRETIVFRSVDDNIEYKVTVMSFLQAQAEGAAILGEREYMFQDDKKVLMDTFGRVEPGKEAIYGRKITIELPKNGGRETAAFYFTKGKMYVLEATVLPANGDYATPDTGRFIDSITFNLDRAEKSATELKLPE |
| ⦗Top⦘ |