


| Basic Information | |
|---|---|
| Taxon OID | 3300023481 Open in IMG/M |
| Scaffold ID | Ga0257022_1004466 Open in IMG/M |
| Source Dataset Name | Marine microbial mat from Loihi Seamount, Hawaii, USA - Ku'kulu Base Individual Assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Western Washington University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2884 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mats From Loihi Seamount, Hawaii, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Loihi Seamount, Hawaii, USA | |||||||
| Coordinates | Lat. (o) | 18.903 | Long. (o) | -155.257 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054937 | Metagenome / Metatranscriptome | 139 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0257022_10044662 | F054937 | GGAG | MATKPNKKKKEKAPETSITSKTQFKDVDRTMEIVEQRAGVATKNGLPSTYTKIKLPSGTIKESYGERYGKPDNS |
| ⦗Top⦘ |