NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256681_12183748

Scaffold Ga0256681_12183748


Overview

Basic Information
Taxon OID3300023311 Open in IMG/M
Scaffold IDGa0256681_12183748 Open in IMG/M
Source Dataset NameCombined Assembly of Gp0281739, Gp0281740, Gp0281741
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLaval University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)511
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location
Location NameSAS2a, Kuujjuarapick, Canada
CoordinatesLat. (o)55.1491Long. (o)-77.4866Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027399Metagenome194Y

Sequences

Protein IDFamilyRBSSequence
Ga0256681_121837483F027399N/AFTFTWILDKFGFQPKVETFDFPLKPAVKKTVKKSVKIPKATTRKPSTKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.