


| Basic Information | |
|---|---|
| Taxon OID | 3300023301 Open in IMG/M |
| Scaffold ID | Ga0209414_1141623 Open in IMG/M |
| Source Dataset Name | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 519 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lightbulbvirus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Lake Vida, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Vida, Antarctica | |||||||
| Coordinates | Lat. (o) | -77.38861 | Long. (o) | 161.931111 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022552 | Metagenome | 214 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209414_11416232 | F022552 | N/A | MTHTETINGKEVFFETVSVAERIEHSTTHFMNGYTGDKLTHTAIVSFAIGSDDFEEISYIEEVEDVDAHLNEIK |
| ⦗Top⦘ |