


| Basic Information | |
|---|---|
| Taxon OID | 3300023211 Open in IMG/M |
| Scaffold ID | Ga0255842_1357338 Open in IMG/M |
| Source Dataset Name | Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? CA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Argonne National Laboratory |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1224 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Ppcp Degradation By Aerobic Enrichment Cultures (Carbon Source) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Fort Collins, Colorado, USA | |||||||
| Coordinates | Lat. (o) | 40.585258 | Long. (o) | -105.084419 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021141 | Metagenome | 220 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255842_13573382 | F021141 | AGCAG | MSNVLVNFRLNPDRPVRVKWLATDGVPGDGYKAQVTAVRMGGITLHMDSSAILEQTAPDPAGGIGGYLVTFNGMVGYAEDHPDRKHVEALTDAEIEYDLTFVHDDDGRLAIQDEDYRVLEQPKAMAHKISARNA |
| ⦗Top⦘ |