


| Basic Information | |
|---|---|
| Taxon OID | 3300022931 Open in IMG/M |
| Scaffold ID | Ga0233433_10017223 Open in IMG/M |
| Source Dataset Name | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Restricted |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4445 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: British Columbia | |||||||
| Coordinates | Lat. (o) | 48.5847 | Long. (o) | -123.5008 | Alt. (m) | Depth (m) | 100 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017933 | Metagenome / Metatranscriptome | 238 | Y |
| F037479 | Metagenome / Metatranscriptome | 168 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0233433_100172233 | F017933 | N/A | MEELIMGVSIVGFSTMLSVMIFNSRKNDNLIRNLCERIAKLEGMLEIKFQEKSD |
| Ga0233433_100172234 | F037479 | AGGA | MEFNGFYNFGGGGTEIIVGVANDNLPSHTENVCANEKMLFTGQFANLSRQLIHITFRGFGSAQAFHRHDLRAYESIEIFNVPLASMSVSVPAGESIGFHGMGTIWTAQDEDEYAIMGAKSGMFEKLPNSPNFNTDSYTRVTQAAAATVDLVVSGADEDFAAYKITVSPVAAQIVDLFWTDSANGNVAFIGNLNFAGAGTFVYDFPDSMMRNPQRQGGKLRMTTSTAASTVVDVIGHEVHAGQ |
| ⦗Top⦘ |