


| Basic Information | |
|---|---|
| Taxon OID | 3300022874 Open in IMG/M |
| Scaffold ID | Ga0222685_1005001 Open in IMG/M |
| Source Dataset Name | Saline water microbial communities from Ace Lake, Antarctica - #1077 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3040 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (30.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctica: Ace Lake | |||||||
| Coordinates | Lat. (o) | -68.4725 | Long. (o) | 78.188 | Alt. (m) | Depth (m) | 24 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060838 | Metagenome / Metatranscriptome | 132 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0222685_10050016 | F060838 | N/A | MPTLQYVQPTEGQKELMQKFRDKYETLLNDINGMEINQSRGLSLAKTKLEESAMWLNKAITEND |
| ⦗Top⦘ |