NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214917_10171783

Scaffold Ga0214917_10171783


Overview

Basic Information
Taxon OID3300022752 Open in IMG/M
Scaffold IDGa0214917_10171783 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1111
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001732Metagenome / Metatranscriptome644Y

Sequences

Protein IDFamilyRBSSequence
Ga0214917_101717831F001732N/ALLLMLAFLFTGCFSTIRPPRPVDDNQKVIAKEEKKVDNTLVEMEKNDKGKRIQTSGLSVGIQHALNQVTNAPIQVDTARKLNERVISIVGSPHIDEIKRIKATVDLLNSALVEERKKGEELLAQRDDIINKLQKEKSELNQKYDDQLWQLTDKAKEVAKEADQNKAVLDSMSGMFGLNAVFWGLKKFIFSALTAITIFVVIFVILRLLATVHPAAGAAFSIFNMLGSAIISILKALTPKAFEMCNYATKDKVDEFKSPLVKIVDVIQELKEKQKESPDRVYPLTEILKRFDKEMDSDEKDLIDNILREQKWIK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.