


| Basic Information | |
|---|---|
| Taxon OID | 3300022654 Open in IMG/M |
| Scaffold ID | Ga0216347_10162761 Open in IMG/M |
| Source Dataset Name | Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Alfalfa, Gen0, Rep 2, Chloramphenicol (v2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1440 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CAG:74_58_120 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 34.4148 | Long. (o) | -119.8405 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061388 | Metagenome | 132 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0216347_101627614 | F061388 | N/A | VLAILQNAPDHIRAMWEQYAAQFRATNMRRDNGAFYSPRDDSVHLHIASVARGDAISTPYSVLFHEYGHMTDYLIARSEGQGRYSAYSELFQGIGPGNKPIIRSGSGGGLLGRTAKDELEGHLSRLRRQNPGMTREQAARSLVSEAMGKYSMRDRSDISDMFEGAGIGISYPLGSGHGLDYWTTRDSGKEIFAEIISAEASHPGSLTAIKDYFPRTYKVYQDMMKARKRR |
| ⦗Top⦘ |