


| Basic Information | |
|---|---|
| Taxon OID | 3300022602 Open in IMG/M |
| Scaffold ID | Ga0248169_101432 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | U.S. Department of Energy (DOE) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 33315 |
| Total Scaffold Genes | 51 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 39 (76.47%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Trout Bog Lake, Vilas County, Wisconsin, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Trout Bog, Vilas County, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 46.0412 | Long. (o) | -89.6861 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F080592 | Metagenome | 115 | N |
| F098536 | Metagenome | 103 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0248169_10143227 | F098536 | AGGAG | MQNKYLSEDDIKQVFFQTKMDDPNGYDFDELLDFADKVILTASFNIARTERELCIEFVESLNSEVAKALREKRGNL |
| Ga0248169_10143248 | F080592 | AGGAG | MSLFVRIVNNQVVDCWDTPPAEGVGNNGWKNAVEVRPTIIPNRQGYTAHTFDLTKDPVEIVYGTFDISVDDRKAGMKSNAAFTFQQVVNQQARNGSAYDANAVATALTAMQTRETAIDACTTHDQLDALN |
| ⦗Top⦘ |