


| Basic Information | |
|---|---|
| Taxon OID | 3300022599 Open in IMG/M |
| Scaffold ID | Ga0215181_1027609 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of coral microbial communities from Popa Island, Bocas del Toro, Panama - APAL C2 (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 542 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Panama: Bocas del Toro | |||||||
| Coordinates | Lat. (o) | 9.1956 | Long. (o) | -82.1254 | Alt. (m) | Depth (m) | 15 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F100360 | Metagenome / Metatranscriptome | 102 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0215181_10276091 | F100360 | N/A | NAVYRFQIPALVPEIFKFEKCLKYANEMTDDVIHSTQHYIICLSRAILANLQRRSLKLGRLIVL |
| ⦗Top⦘ |