


| Basic Information | |
|---|---|
| Taxon OID | 3300022516 Open in IMG/M |
| Scaffold ID | Ga0224542_1025917 Open in IMG/M |
| Source Dataset Name | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 30-34 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 750 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Norrbotten County, Stordalen Mire | |||||||
| Coordinates | Lat. (o) | 68.3533 | Long. (o) | 19.0466 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000451 | Metagenome / Metatranscriptome | 1124 | Y |
| F026958 | Metagenome / Metatranscriptome | 196 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0224542_10259171 | F026958 | AGGCGG | MADQAERVILEAEDNVTPIVARANAGLESFEKKAESSHGKVIRITDQTRTSIQRLIASLEKQAEVYGKSGVDRLISQR |
| Ga0224542_10259172 | F000451 | GGCGG | MPRFQTVIRKARFVYSPYTAYEMQGFAQVLADSIRARIQSGQNIYDQAAAPLKPGKPGRRGYPDYKAARGLQPIRDWTWSGHTLRCLKVLTANENRAAIGFLDEAMPGRRQTASQIAFYNNQRERQWGVSPRDRQAVLAAFVARPIVMLKAA |
| ⦗Top⦘ |