


| Basic Information | |
|---|---|
| Taxon OID | 3300022177 Open in IMG/M |
| Scaffold ID | Ga0228536_1001026 Open in IMG/M |
| Source Dataset Name | Enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.S |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 34055 |
| Total Scaffold Genes | 32 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 25 (78.12%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: New York | |||||||
| Coordinates | Lat. (o) | 42.4447 | Long. (o) | -76.485 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041288 | Metagenome / Metatranscriptome | 160 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0228536_100102629 | F041288 | AGGAGG | MFKRFSSSLYFLQLGVAITFLILAGIASSATLLKSRLLPTEQILKSSLGSEKFNTLRFETYGGLPENRMIGYFLYREGISVKGDGPQIESIGKLSLNEVLADHERVARAKFYGRLGHVMIREITREGDVVGYAVNDPKMEITLWDVTKYPSAISLELRYKDLQPKGERYDAGPR |
| ⦗Top⦘ |