


| Basic Information | |
|---|---|
| Taxon OID | 3300022169 Open in IMG/M |
| Scaffold ID | Ga0196903_1002979 Open in IMG/M |
| Source Dataset Name | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2293 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Chesapeake Bay | |||||||
| Coordinates | Lat. (o) | 37.1 | Long. (o) | -76.0972 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028500 | Metagenome / Metatranscriptome | 191 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0196903_10029792 | F028500 | GAG | MFRIGTAMYEIRTMWTNLVVYRTTERANALYWLEENNQEGVFKLVAVK |
| ⦗Top⦘ |