


| Basic Information | |
|---|---|
| Taxon OID | 3300021966 Open in IMG/M |
| Scaffold ID | Ga0226662_10041208 Open in IMG/M |
| Source Dataset Name | Food waste microbial community from Durham, Ontario, Canada - FW2 spades |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Toronto |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1857 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Durham, Ontario, Canada | |||||||
| Coordinates | Lat. (o) | 43.6629 | Long. (o) | -79.3957 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F065281 | Metagenome | 127 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0226662_100412083 | F065281 | AGGAGG | MAKKSIITSFRLNEDDYLKLKALKEKYGVSWTKLVAHINKILEQEMKDAKEK |
| ⦗Top⦘ |