


| Basic Information | |
|---|---|
| Taxon OID | 3300021791 Open in IMG/M |
| Scaffold ID | Ga0226832_10211066 Open in IMG/M |
| Source Dataset Name | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 763 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Daikoku vent field, Mariana back arc basin | |||||||
| Coordinates | Lat. (o) | 21.3250983 | Long. (o) | 144.19162955 | Alt. (m) | Depth (m) | 409.13 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001493 | Metagenome | 683 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0226832_102110661 | F001493 | N/A | MITFKQFIKEGPHYKPAWTESLSTMLFDLPREGLKDAKIPLSPAIFKRVWPKSIRSKAFHLTDLIGVQRLKKMQGKKKSVSAFYNMSDYMIQSGIRTEGGYVVELEGDVLAAAPDDISSQPDKTGRRWLTFSTLMNKSTASDPGLDGASKLKKMESDLQNLLVEILGKNGKGPYRPGDTNVIAKAWSYLGKSVGGKEKSIIIKDYIDGMEKIMKKYSKPLKSVFTDYTKKRTLDPDEDSG |
| ⦗Top⦘ |