


| Basic Information | |
|---|---|
| Taxon OID | 3300021354 Open in IMG/M |
| Scaffold ID | Ga0194047_10207612 Open in IMG/M |
| Source Dataset Name | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 776 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Ontario | |||||||
| Coordinates | Lat. (o) | 49.701 | Long. (o) | -93.727 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029367 | Metagenome | 188 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0194047_102076122 | F029367 | AGGAG | MKAEHSEFDCMVCEHPDAQGVDLECYFEPNTTNLWFVYIGDALITDLLRDTVIQSLERGYVKACKEQLDNDKLDYALARYESKHYEV |
| ⦗Top⦘ |