


| Basic Information | |
|---|---|
| Taxon OID | 3300021317 Open in IMG/M |
| Scaffold ID | Ga0210309_1116831 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1411 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Washington | |||||||
| Coordinates | Lat. (o) | 46.295 | Long. (o) | -124.183 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001506 | Metagenome / Metatranscriptome | 681 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0210309_11168311 | F001506 | N/A | MNRILYDSRCRCKEEFSITKKRKPSGRSEGKPLQYPNEIMSKTFQIKYEKKLSLVARFILTSFRNKYLYYAIDDILYLLKANPIERENLLSILYSPVLSLQNNFCINFFDIWIYEVYVNETSKKNKFLNQECDNLERFNSITVKFLYKTRLPVKKVESLW |
| ⦗Top⦘ |