NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0223825_11879768

Scaffold Ga0223825_11879768


Overview

Basic Information
Taxon OID3300021255 Open in IMG/M
Scaffold IDGa0223825_11879768 Open in IMG/M
Source Dataset NameSheep rumen microbial communities from New Zealand - Tag 1494 SPADES assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)798
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Cattle And Sheep Rumen → Cattle And Sheep Rumen Microbial Communities From New Zealand, For Comparative Studies

Source Dataset Sampling Location
Location NameNew Zealand
CoordinatesLat. (o)-42.26Long. (o)171.6Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016102Metagenome / Metatranscriptome249Y

Sequences

Protein IDFamilyRBSSequence
Ga0223825_118797681F016102N/AMSKIEYRKINFPKINWNEEDSEESTPELSQENYNSLKDVLDTITNNKSINPHLIQDGLRSINFHKEKPDIYKIIEEMCLEYDLKGKEMNTKEILNYVINSLSDIKTRKGLNSLFDEIKDKKTGEITPKELAQISKDNEDNLDEKDFQFILNTIAGNSNSININQDEFYYIMTKSPEEALKITLATKSSKIK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.