


| Basic Information | |
|---|---|
| Taxon OID | 3300021184 Open in IMG/M |
| Scaffold ID | Ga0196959_10046401 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 891 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 33.3049 | Long. (o) | -116.2547 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015257 | Metagenome / Metatranscriptome | 256 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0196959_100464012 | F015257 | N/A | MITTTLQQIIDERISFLKEQINPANKPEVNKTFQIQIDAIRSAAHDIEKVESLILQKNEQLKSSKDVYESDRIFAELDGLEWLQRQITVYALVGGTMKEGVNT |
| ⦗Top⦘ |