


| Basic Information | |
|---|---|
| Taxon OID | 3300021081 Open in IMG/M |
| Scaffold ID | Ga0210379_10171127 Open in IMG/M |
| Source Dataset Name | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 929 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: East River, Colorado | |||||||
| Coordinates | Lat. (o) | 38.9208 | Long. (o) | -106.9484 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F065584 | Metagenome | 127 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0210379_101711271 | F065584 | N/A | LAYLVERREGNRTVQQVVRADLVTGSVTPLTGTDLALTSFAVSLSGDLVALVVNAQPENRRNPIYKVYIQPVGSGTPVPMPTVGTEQMVTPTFRP |
| ⦗Top⦘ |