


| Basic Information | |
|---|---|
| Taxon OID | 3300020524 Open in IMG/M |
| Scaffold ID | Ga0208858_1000121 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 18303 |
| Total Scaffold Genes | 18 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (16.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Mendota, Madison, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 43.098333 | Long. (o) | -89.405278 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043782 | Metagenome / Metatranscriptome | 155 | N |
| F071985 | Metagenome / Metatranscriptome | 121 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208858_10001215 | F043782 | N/A | MKKYKVIIWILVTINIGLIAFMFFQHRPHPRPRIVNILNIEDARAKEINRKELIHFNKKKTLMDKSKKLRAQLLLSFENELPESQADSILKLISANQYELDKMTYLYFKDIKSQCSAKERKQLNGFFTRVLEGGPRHKK |
| Ga0208858_10001216 | F071985 | N/A | MKELEDFTFSSRIEVSEELAKKLAMIPSQSQAPSIHFYYAAAAIALLISINLFAVLYSNQTKKINIENTEYFEEWN |
| ⦗Top⦘ |