


| Basic Information | |
|---|---|
| Taxon OID | 3300020464 Open in IMG/M |
| Scaffold ID | Ga0211694_10419827 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 576 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_078 | |||||||
| Coordinates | Lat. (o) | -30.1495 | Long. (o) | -43.2486 | Alt. (m) | Depth (m) | 120 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F044592 | Metagenome | 154 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211694_104198273 | F044592 | GAGG | MKAGDLVKYKGEVGIVLGPCRKRWAKDGDVWVLWPHKDKPIIENGKFLEAVNESR |
| ⦗Top⦘ |