


| Basic Information | |
|---|---|
| Taxon OID | 3300020408 Open in IMG/M |
| Scaffold ID | Ga0211651_10026826 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2715 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (81.82%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_109 | |||||||
| Coordinates | Lat. (o) | 2.0596 | Long. (o) | -84.553 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049928 | Metagenome | 146 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211651_100268267 | F049928 | AGGA | MINFVTNREYNGKNVDILMASGKGTEFAGFHQGKKFFGVNGNQLKGMKAAAVVQFVVEKKDSEGKESKSIRYKSVFAKSDFENAIKNNKKEVV |
| ⦗Top⦘ |