


| Basic Information | |
|---|---|
| Taxon OID | 3300020160 Open in IMG/M |
| Scaffold ID | Ga0211733_10834282 Open in IMG/M |
| Source Dataset Name | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | SciLifeLab |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5431 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (13.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Erken, Sweden | |||||||
| Coordinates | Lat. (o) | 59.83763399 | Long. (o) | 18.6203826 | Alt. (m) | Depth (m) | 0 to 10 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017300 | Metagenome / Metatranscriptome | 241 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211733_1083428214 | F017300 | N/A | MNKVTVAADKNGNVIGISPNNPEYGWIRVEQSARVINDRGWLRNSTRSALIKGKVEDLVAANYKQGEEITGKIIVVESFNAFNPENPDRDLKIAGDTGIICRVDDQPIYRQTFFTPNVNAEDELIMHTNAEEIKGVQSAQRGLKSIGNSILKELEPDFK |
| ⦗Top⦘ |