


| Basic Information | |
|---|---|
| Taxon OID | 3300020062 Open in IMG/M |
| Scaffold ID | Ga0193724_1001065 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6266 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: East River, Colorado | |||||||
| Coordinates | Lat. (o) | 38.9866 | Long. (o) | -107.0007 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003294 | Metagenome / Metatranscriptome | 495 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193724_10010652 | F003294 | AGTAG | MKRKRINLLIVTALVVCAGYAIAGDKIDVPRVITKSDAEKILGVPVKDAKGRNQNGTGGYYESEWSYRAIEGDKGVYFDVLYAGRDAPPHLTQTMFSMLPADGSKSTRIDGLGDKAVFCPNETGMAMLHVLKGDILVTIGIHGLPANAVLDSEKSMATRILANL |
| ⦗Top⦘ |