


| Basic Information | |
|---|---|
| Taxon OID | 3300019881 Open in IMG/M |
| Scaffold ID | Ga0193707_1001237 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 9255 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (69.23%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: East River, Colorado | |||||||
| Coordinates | Lat. (o) | 38.9206 | Long. (o) | -106.9514 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006194 | Metagenome / Metatranscriptome | 379 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193707_10012373 | F006194 | N/A | MSGRPDRKEEGGKGARRAAKRDDKRVARNASSKAYMNLAAALATVFAAGVYTREELQAAVCTFVSEMKDGGETGEGVVKAAQVLVAEVGTRFPASERTQTLLGDMVTWCLAEYYRETA |
| ⦗Top⦘ |