


| Basic Information | |
|---|---|
| Taxon OID | 3300019487 Open in IMG/M |
| Scaffold ID | Ga0187893_10863170 Open in IMG/M |
| Source Dataset Name | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 544 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: the Island of Hawaii | |||||||
| Coordinates | Lat. (o) | 19.0643 | Long. (o) | -155.8008 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027665 | Metagenome | 194 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187893_108631702 | F027665 | AGGAGG | MAISPVPRRSSQLPLFARPQCNPHWTDLASDVQRKIVRLLAQLLRRHRGTLAEAEIAEEAPSE |
| ⦗Top⦘ |