


| Basic Information | |
|---|---|
| Taxon OID | 3300019228 Open in IMG/M |
| Scaffold ID | Ga0180119_1399904 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7862 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Riboviria → Orthornavirae → Kitrinoviricota → Alsuviricetes → Martellivirales → Togaviridae → Alphavirus → unclassified Alphavirus → Fusarium sacchari alphavirus-like virus 1 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: East River, Colorado | |||||||
| Coordinates | Lat. (o) | 38.9225 | Long. (o) | -106.9514 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068861 | Metagenome / Metatranscriptome | 124 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0180119_13999043 | F068861 | GAGG | MVSQTATRLIAEYGSDEDYKFAGALQLKTATTLSSVFGNVLRYEPWTNSGAKELLKHHPVAVWKHLVVRLAPRPGIYGRMCTFYGGWAAAGVEKPTTVEEMISLHGAIDVTYGGTGDPGTVRVEIPCAFDDTMKDLLKGPDNDSARPVFFYCFTESAVVDKPPDSDRFMLTFKGAYTLHGRY |
| ⦗Top⦘ |