


| Basic Information | |
|---|---|
| Taxon OID | 3300019214 Open in IMG/M |
| Scaffold ID | Ga0180037_1150659 Open in IMG/M |
| Source Dataset Name | Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1341 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oregon | |||||||
| Coordinates | Lat. (o) | 46.234 | Long. (o) | -123.91 | Alt. (m) | Depth (m) | 9 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004712 | Metagenome / Metatranscriptome | 427 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0180037_11506592 | F004712 | AGGA | MSIVTIVTSQAPDAKPVAVNLVLSTNWQEIINVPNYEVPELVFGGSTTVEPGVGEVISPLVLCNTSASTVNVDVQVYRYDTNTNFYIIRNMPVPSYDTIPIPLNGQFLKSGDILEAKASADLAIHSTLSFTLGQSEEDDVV |
| ⦗Top⦘ |