


| Basic Information | |
|---|---|
| Taxon OID | 3300018988 Open in IMG/M |
| Scaffold ID | Ga0193275_10241358 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 567 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Pacific Ocean: TARA_097 | |||||||
| Coordinates | Lat. (o) | -25.826 | Long. (o) | -111.7294 | Alt. (m) | Depth (m) | 188 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F083660 | Metatranscriptome | 112 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193275_102413581 | F083660 | N/A | FVIQEGAKTSEGVIVDYDKFIIQKINEFPVTLRPKSGADDRILQISLDGTQDIRHVKAKLCEAMEVPSSANVNIYECISSMGATANPLKKRAFRRPMEQPVVDEDPRKVTELFRHCEDGTRTLYYNL |
| ⦗Top⦘ |