


| Basic Information | |
|---|---|
| Taxon OID | 3300018953 Open in IMG/M |
| Scaffold ID | Ga0193567_10072594 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002753 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1143 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Atlantic Ocean: TARA_151 | |||||||
| Coordinates | Lat. (o) | 36.1631 | Long. (o) | -29.0143 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006050 | Metatranscriptome | 382 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193567_100725941 | F006050 | AGGA | MRRQGFASVFSVLVLSSCILEGYTLPQQRYTADEYGRKFGSAPIDEISNEIDETESEPALAKEEGSLLTTVLELGMKFVPMLIDALSGSTGPSQTDRIEGIDLNGEDPFSMRNLAFLGLKLFLAIAGGTSTSNSIEKNDNFSPMQPLMGAVIGALTGSDDPNEVAVMAKQASEVINLVVTLVEALTTSMSQRSFDY |
| ⦗Top⦘ |