


| Basic Information | |
|---|---|
| Taxon OID | 3300018877 Open in IMG/M |
| Scaffold ID | Ga0193600_1103646 Open in IMG/M |
| Source Dataset Name | Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 42 hrs after wetting v1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | QB3 Vincent J. Coates Genomics Sequencing Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 665 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Desert → Soil → Biological Soil Crust Microbial Communities From Moab Desert, Utah To Study Responses To Pulsed Climate Events |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Utah, Colorado Plateau, Green Butte Site | |||||||
| Coordinates | Lat. (o) | 38.712053 | Long. (o) | -109.695097 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037654 | Metagenome | 167 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193600_11036461 | F037654 | AGGA | MAASEFQRTLMANLSRQGMSIAGLARQTGYSPVLLENLIAGKSRQIPVDFFIRVADALALTTVEKDALVRSWAFGIEKRSWSLSSA |
| ⦗Top⦘ |