


| Basic Information | |
|---|---|
| Taxon OID | 3300018775 Open in IMG/M |
| Scaffold ID | Ga0188848_1026556 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 613 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Baltic Sea | |||||||
| Coordinates | Lat. (o) | 56.1664 | Long. (o) | 16.378218 | Alt. (m) | Depth (m) | .3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F089902 | Metagenome / Metatranscriptome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0188848_10265562 | F089902 | GGA | MTDRAKKLMDEIYHERNTWADTEEKLVAAVIRKTIDNCRILVASKAGNLTVIDRGDMMQLSKEVENL |
| ⦗Top⦘ |