


| Basic Information | |
|---|---|
| Taxon OID | 3300018682 Open in IMG/M |
| Scaffold ID | Ga0188851_1007605 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1498 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Baltic Sea | |||||||
| Coordinates | Lat. (o) | 56.1664 | Long. (o) | 16.378218 | Alt. (m) | Depth (m) | 4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F067689 | Metagenome / Metatranscriptome | 125 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0188851_10076051 | F067689 | N/A | MAFTDSYSFSHRFSSDKATDDTAGYQEIIHQCQEVNAFGLTRQFYQFMLGCGYAPQSVVAAFETMAAEYGEAHCGDKAE |
| ⦗Top⦘ |