


| Basic Information | |
|---|---|
| Taxon OID | 3300018432 Open in IMG/M |
| Scaffold ID | Ga0190275_12296828 Open in IMG/M |
| Source Dataset Name | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 618 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Montana | |||||||
| Coordinates | Lat. (o) | 45.2639 | Long. (o) | -110.8632 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039202 | Metagenome / Metatranscriptome | 164 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0190275_122968281 | F039202 | AGAAG | VLQDAHKALEAMSAGCTAIKDEQWGEAERALHQVQETVGRLLREVGDKVPEKMQAPPPETGDRG |
| ⦗Top⦘ |