NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187887_10006468

Scaffold Ga0187887_10006468


Overview

Basic Information
Taxon OID3300018043 Open in IMG/M
Scaffold IDGa0187887_10006468 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8394
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (81.82%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002101Metagenome / Metatranscriptome593Y
F004095Metagenome / Metatranscriptome453Y

Sequences

Protein IDFamilyRBSSequence
Ga0187887_100064684F002101AGGAGVTNIALPLPPPEGSLEKKKRVLLLDTSQTKRDLRAEVMRRLGIDVDCAADVLEARCWWRADLYNLVLINAIGEAESRDKFCTDIRNAIPPQKIAFFVGGPEYLSSAPNSDAARVEADPDTVHKQMVAALLAKSLQNSSQRWGILEACKRISSVRSVSEARSRAIRETPRPSRWAEAIEQHSASEEIHSQPIFANAIAASEREGIL
Ga0187887_100064685F004095AGGAGMSGINGDKARFNRRRRQKISRRISNHKMLKALEEKHLTPPAAPSNLKEKSA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.