


| Basic Information | |
|---|---|
| Taxon OID | 3300017930 Open in IMG/M |
| Scaffold ID | Ga0187825_10106716 Open in IMG/M |
| Source Dataset Name | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 972 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: North Carolina | |||||||
| Coordinates | Lat. (o) | 35.9061 | Long. (o) | -76.1569 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016311 | Metagenome / Metatranscriptome | 248 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187825_101067161 | F016311 | AGGAGG | MRGFIIGVLIIGVAVLGYLYWDSEHNTIFKAPGVEIKKN |
| ⦗Top⦘ |