


| Basic Information | |
|---|---|
| Taxon OID | 3300017761 Open in IMG/M |
| Scaffold ID | Ga0181356_1236668 Open in IMG/M |
| Source Dataset Name | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 525 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 43.1998 | Long. (o) | -86.5698 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002135 | Metagenome / Metatranscriptome | 590 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181356_12366681 | F002135 | N/A | MANTRKRKKINRRVVRRSPDPLSKLEVFYIAKHEMFKAARKAGFSEPVALALMDSPSSMPDWVVGADGIIPSIPTPDEDDD |
| ⦗Top⦘ |